DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psma4

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:129/249 - (51%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTV---EKIVE 69
            ||.....|||||||:|||||:|||....|.:||...:||:||.|:|....|:  ..|   |||.:
  Rat     5 YDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLL--DEVFFSEKIYK 67

  Fly    70 VDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA------IQFGDSGD 128
            :::.:.|:.:|:.:||..|....|:..|.:...|.|.:   .|.|.|:.|.      .|||.   
  Rat    68 LNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPI---PCEQLVTALCDIKQAYTQFGG--- 126

  Fly   129 SDGAAAMSRPFGVAILFAGIEAGQP-QLWHMDPSGTFVRHGAKAIGSGSEGAQQNL-QDLFRPDL 191
                   .|||||::|:.|.:.... ||:..||||.:....|..||:.|..|...| ||....::
  Rat   127 -------KRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEM 184

  Fly   192 TLDEAIDISLNTLKQVME-EKLNSTNVEVMTMTKER---EFYMFTKEEVEQHIK 241
            ||..|:.:::..|.:.|: .||::..||:.|:|:|.   ...:..::||||.||
  Rat   185 TLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 86/249 (35%)
proteasome_alpha_type_5 8..222 CDD:239722 77/225 (34%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 77/225 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.