DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psma3

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:241 Identity:75/241 - (31%)
Similarity:123/241 - (51%) Gaps:14/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVDK 72
            ||...:||||:||:||||||::|::..||||||...:|||..|||.:.|.|....:.:::..||:
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR 137
            |:|.|.:||:||||:|.:.||.|..|....:...:.::..|..|:.....:       ...:..|
  Rat    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAY-------TLYSAVR 130

  Fly   138 PFGVAILFAGIEAGQ-PQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISL 201
            |||.:.:........ .||:.:||||....:...|||...:.|:..::.|...::|..:.:....
  Rat   131 PFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVA 195

  Fly   202 NTLKQVMEE-KLNSTNVE---VMTMTKEREFYM--FTKEEVEQHIK 241
            ..:..|.:| |..:..:|   |..:||.|...:  ..:||.|::.|
  Rat   196 KIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYAK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 75/241 (31%)
proteasome_alpha_type_5 8..222 CDD:239722 68/218 (31%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 67/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.