DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psma4

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_036096.1 Gene:Psma4 / 26441 MGIID:1347060 Length:261 Species:Mus musculus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:129/249 - (51%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTV---EKIVE 69
            ||.....|||||||:|||||:|||....|.:||...:||:||.|:|....|:  ..|   |||.:
Mouse     5 YDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLL--DEVFFSEKIYK 67

  Fly    70 VDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA------IQFGDSGD 128
            :::.:.|:.:|:.:||..|....|:..|.:...|.|.:   .|.|.|:.|.      .|||.   
Mouse    68 LNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPI---PCEQLVTALCDIKQAYTQFGG--- 126

  Fly   129 SDGAAAMSRPFGVAILFAGIEAGQP-QLWHMDPSGTFVRHGAKAIGSGSEGAQQNL-QDLFRPDL 191
                   .|||||::|:.|.:.... ||:..||||.:....|..||:.|..|...| ||....::
Mouse   127 -------KRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEM 184

  Fly   192 TLDEAIDISLNTLKQVME-EKLNSTNVEVMTMTKE---REFYMFTKEEVEQHIK 241
            ||..|:.:::..|.:.|: .||::..||:.|:|:|   ....:..::||||.||
Mouse   185 TLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 86/249 (35%)
proteasome_alpha_type_5 8..222 CDD:239722 77/225 (34%)
Psma4NP_036096.1 proteasome_alpha_type_4 3..216 CDD:239721 77/225 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.