DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psmb8

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:182 Identity:44/182 - (24%)
Similarity:89/182 - (48%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMA 83
            |..|:|.|     .|:|.:......||::||:.|.::...:.: .|.|::|::.::....||..|
  Rat    63 RKVQIEMA-----HGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGCAA 122

  Fly    84 DARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGI 148
            |.:........||:.::....||:|:.:.::.:|.:.:|:...|.|.|:           :..|.
  Rat   123 DCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGS-----------MICGW 176

  Fly   149 EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS 200
            :...|.|:::|.:||.:.....:.|||:..|...:...:|.||:.:||.|::
  Rat   177 DKKGPGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 44/182 (24%)
proteasome_alpha_type_5 8..222 CDD:239722 44/182 (24%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 44/182 (24%)
proteasome_beta_type_5 73..260 CDD:239730 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.