DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and CG30382

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:133/241 - (55%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVD 71
            :||.:..|||||||:|||||.:|| :...|.:.:.:.:..|:|.:|::|...:||.||..:..:.
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73

  Fly    72 KHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMS 136
            |.||||.:|.:||:|:.:::||.|..|..:.|...|.::...:.::.:...:..:       |..
  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQN-------AEM 131

  Fly   137 RPFGVAILFAGI--EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDI 199
            ||.|.:::....  |.| |.::..||:|.|....|.::|:.:..|...|:..::|:|:.::||.:
  Fly   132 RPLGCSMVLIAYDNEIG-PSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQL 195

  Fly   200 SLNTLKQVMEEKLNSTNVEVMTMTK-EREFYMFTKEEVEQHIKNIA 244
            :::.|..|:........:|:..::| :..|.:..:.|:|:|:..||
  Fly   196 AISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 67/238 (28%)
proteasome_alpha_type_5 8..222 CDD:239722 62/216 (29%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 69/241 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 62/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.