DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psmb5

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_035316.1 Gene:Psmb5 / 19173 MGIID:1194513 Length:264 Species:Mus musculus


Alignment Length:179 Identity:44/179 - (24%)
Similarity:86/179 - (48%) Gaps:22/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMADA----RTLIERAR 93
            |:|.:......||::|.:.|.|:...:.| ||:|::|::.::....:|..||.    |.|..:.|
Mouse    59 GTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCR 123

  Fly    94 V-ECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWH 157
            : |.:|     .||:|:.:.::.::.:..|:...|.|.|.           :..|.:...|.|::
Mouse   124 IYELRN-----KERISVAAASKLLANMVYQYKGMGLSMGT-----------MICGWDKRGPGLYY 172

  Fly   158 MDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQ 206
            :|..|..:...|.::||||..|...:...:..||.::||.|::...:.|
Mouse   173 VDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 44/179 (25%)
proteasome_alpha_type_5 8..222 CDD:239722 44/179 (25%)
Psmb5NP_035316.1 proteasome_beta_type_5 60..247 CDD:239730 43/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.