DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psmb10

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:207 Identity:50/207 - (24%)
Similarity:91/207 - (43%) Gaps:36/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AIKLGSTAIGICTPEGVVLAVEKRITSPLMV-PSTVEKIVEVDKHIGCATSGLMADARTLIERAR 93
            |.|.|:|..|:...:||:|..:.|.|:..:| ..:.|||..:...|.|..:|:.||.......|.
Mouse    35 ARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAA 99

  Fly    94 VECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR-----------PFGVAILFAG 147
            .:.:.|               |:||        |.....|.::|           ..|.:::..|
Mouse   100 SKMELH---------------ALST--------GREPRVATVTRILRQTLFRYQGHVGASLVVGG 141

  Fly   148 IEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQ-VMEEK 211
            ::...|||:.:.|.|::.|....|:|||...|...|:|.|:|::||:.|.::.:..:.. ::.:.
Mouse   142 VDLNGPQLYEVHPHGSYSRLPFTALGSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGILSDL 206

  Fly   212 LNSTNVEVMTMT 223
            .:..||:...:|
Mouse   207 GSGGNVDACVIT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 50/207 (24%)
proteasome_alpha_type_5 8..222 CDD:239722 49/204 (24%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 48/203 (24%)
proteasome_beta_type_7 40..226 CDD:239732 47/202 (23%)
Pr_beta_C 232..267 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.