DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and Psmb1

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus


Alignment Length:256 Identity:64/256 - (25%)
Similarity:98/256 - (38%) Gaps:84/256 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRIT---------SPLMVPSTVEKIVEV 70
            |||        ||..    |.|.:.|...:..::|.:.|::         ||.....| :|.|  
Mouse    29 FSP--------YAFN----GGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLT-DKTV-- 78

  Fly    71 DKHIGCATSGLMADARTL--IERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAA 133
               |||  ||...|..||  |..||::...|  ..|:.|:..:.|..:||:              
Mouse    79 ---IGC--SGFHGDCLTLTKIIEARLKMYKH--SNNKAMTTGAIAAMLSTI-------------- 122

  Fly   134 AMSR---PFGVAILFAGI-EAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQ---------QNLQD 185
            ..||   |:.|..:..|: |.|:..::..||.|::.|...||.||.|...|         :|:|:
Mouse   123 LYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN 187

  Fly   186 LFRPDLTLDEAIDISLNTLKQVMEEKLNSTNVEVMTMTKEREFY--------MFTKEEVEQ 238
            :....||||.|    :..:|            :|.....||:.|        :.|||.:.:
Mouse   188 VEHVPLTLDRA----MRLVK------------DVFISAAERDVYTGDALRICIVTKEGIRE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 64/256 (25%)
proteasome_alpha_type_5 8..222 CDD:239722 58/230 (25%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 64/256 (25%)
proteasome_beta_type_1 29..240 CDD:239726 64/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.