DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and pbs-6

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_498806.1 Gene:pbs-6 / 176161 WormBaseID:WBGene00003952 Length:258 Species:Caenorhabditis elegans


Alignment Length:233 Identity:54/233 - (23%)
Similarity:87/233 - (37%) Gaps:75/233 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEG---VVLAVEKRITSP--LMVPSTVEKIVEVDK 72
            |.:|.||              |||    |...|   .::|.:.|:|..  .::....|||..::.
 Worm    45 NPYSMEG--------------GST----CAISGENFAIVASDTRMTQNDINILTRDAEKIQILND 91

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR 137
            :|...|||...|...|.:..:.....:.|.|...||::.||:                   .:||
 Worm    92 NIILTTSGFYGDVLQLKKVLQSRLHKYRFDYRSDMSVDLCAE-------------------LLSR 137

  Fly   138 --------PFGVAILFAGI-EAGQPQLWHMDPSGTFVRHGAKAIGSG-----------------S 176
                    |:....:.||| |.|:..::..||.|...|.|..|.|:.                 |
 Worm   138 NLYYRRFFPYYTGAILAGIDEHGKGAVFSYDPIGCIERLGYSASGAAEPMIIPFLDCQIGHVTLS 202

  Fly   177 EGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNS 214
            ||.:       ||:||||.||.:..::.:...|.::::
 Worm   203 EGYE-------RPELTLDRAISLMKDSFRGAAEREIST 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 54/233 (23%)
proteasome_alpha_type_5 8..222 CDD:239722 54/233 (23%)
pbs-6NP_498806.1 PRE1 38..246 CDD:223711 54/233 (23%)
Ntn_hydrolase 44..258 CDD:294319 54/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.