DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and pas-7

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_496177.2 Gene:pas-7 / 174571 WormBaseID:WBGene00003928 Length:250 Species:Caenorhabditis elegans


Alignment Length:220 Identity:63/220 - (28%)
Similarity:103/220 - (46%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEVDK 72
            ||...:||||:||:||||||.:|:....|.|.|....|||:..:|.|:|.|...:...::..|:.
 Worm     8 YDLAASTFSPDGRIFQVEYAQKAVDNAGTMIAIRGKNGVVVVADKLISSKLYTDNANPRMFNVND 72

  Fly    73 HIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVS------TLAIQFGDSGDSDG 131
            ::|.|.:|...|...|...|..|.......|.|.|.|::.|.:|:      ||.|          
 Worm    73 NVGVAVAGNYPDGFALKNYAYGEAMKWLKDYREPMPIQNIANSVAEYIHIHTLGI---------- 127

  Fly   132 AAAMSRPFGVAILFA--GIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLD 194
                |||||....|.  ..:.| .:|:.::|||....:.|.|:|...:.|:..::.|...:|.::
 Worm   128 ----SRPFGAGAFFMSWNKQTG-GRLFLVEPSGLNYEYKAWAVGKHRQAAKAEIEKLKIEELDVN 187

  Fly   195 EAIDISLNTLKQVMEEKLNSTNVEV 219
            :.:..:...:..|.:|. ...||::
 Worm   188 QLVKEAARIIMVVRDEN-KDKNVQI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 63/220 (29%)
proteasome_alpha_type_5 8..222 CDD:239722 63/220 (29%)
pas-7NP_496177.2 proteasome_alpha_type_3 5..216 CDD:239720 63/220 (29%)
PRE1 6..231 CDD:223711 63/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.