DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and pbs-3

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_494913.1 Gene:pbs-3 / 173858 WormBaseID:WBGene00003949 Length:204 Species:Caenorhabditis elegans


Alignment Length:206 Identity:49/206 - (23%)
Similarity:91/206 - (44%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVE--VDK-HIGCATSGLMADARTLIERARVE 95
            |.|.:.:...|.|.:|.:.||...:...:|.:|.|.  .|| ::|.|  |..:||||::|:....
 Worm     8 GGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLA--GFQSDARTVLEKIMFR 70

  Fly    96 CQNHWFVYNERMSIESCAQAVSTLAIQ--FGDSGDSDGAAAMSRPFGVAILFAGI-EAGQPQLWH 157
            ...:....|..:..:..::.:|.||.|  ||        :..:.|     |.||: :..:|.:..
 Worm    71 KNLYELRENRNIKPQVLSEMISNLAYQHRFG--------SYFTEP-----LVAGLDDTNKPYICC 122

  Fly   158 MDPSG------TFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVME-EKLNST 215
            ||..|      .||     |:|:|.|......::.:|.::..||..:.:..::...:| :..:..
 Worm   123 MDTIGCVSAPRDFV-----AVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAASGW 182

  Fly   216 NVEVMTMTKER 226
            ...|.|:||::
 Worm   183 GAVVYTITKDK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 49/206 (24%)
proteasome_alpha_type_5 8..222 CDD:239722 46/200 (23%)
pbs-3NP_494913.1 PRE1 3..193 CDD:223711 49/204 (24%)
proteasome_beta_type_3 6..200 CDD:239728 49/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.