Sequence 1: | NP_477202.2 | Gene: | Prosalpha5 / 36951 | FlyBaseID: | FBgn0016697 | Length: | 244 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494913.1 | Gene: | pbs-3 / 173858 | WormBaseID: | WBGene00003949 | Length: | 204 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 91/206 - (44%) | Gaps: | 33/206 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 GSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVE--VDK-HIGCATSGLMADARTLIERARVE 95
Fly 96 CQNHWFVYNERMSIESCAQAVSTLAIQ--FGDSGDSDGAAAMSRPFGVAILFAGI-EAGQPQLWH 157
Fly 158 MDPSG------TFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVME-EKLNST 215
Fly 216 NVEVMTMTKER 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha5 | NP_477202.2 | PRK03996 | 8..243 | CDD:235192 | 49/206 (24%) |
proteasome_alpha_type_5 | 8..222 | CDD:239722 | 46/200 (23%) | ||
pbs-3 | NP_494913.1 | PRE1 | 3..193 | CDD:223711 | 49/204 (24%) |
proteasome_beta_type_3 | 6..200 | CDD:239728 | 49/206 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |