DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and AT4G15165

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana


Alignment Length:242 Identity:75/242 - (30%)
Similarity:115/242 - (47%) Gaps:70/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLM-VPSTVEKIVEVD 71
            ||.....|||||||:|||||:|||....:||||...:||||..||::||.|: ..|::||:.::|
plant     5 YDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKMYKID 69

  Fly    72 KHIGCATSGLMADARTLIERARVECQ----NHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGA 132
            .|:.||.:|:|:||..||..|||:.|    ||.|                               
plant    70 DHVACAVAGIMSDANILINTARVQAQRWDRNHGF------------------------------- 103

  Fly   133 AAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAI 197
                                 ||:..||||.:....|.|:|:.::.||..|:..::.|.|.:|.:
plant   104 ---------------------QLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDDATREEVV 147

  Fly   198 DISLNTLKQVMEEKLNSTNVEVMTMTKER----EFYMFTKEEVEQHI 240
            .:::..|.:.|:    ||     ::|.|:    |.|:...:.|:.|:
plant   148 QLAIKVLSKTMD----ST-----SLTAEKLELAELYLTPSKCVKYHV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 75/242 (31%)
proteasome_alpha_type_5 8..222 CDD:239722 69/218 (32%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:382028 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.