DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psmb7.2

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_002941310.2 Gene:psmb7.2 / 100489016 XenbaseID:XB-GENE-479691 Length:279 Species:Xenopus tropicalis


Alignment Length:207 Identity:48/207 - (23%)
Similarity:91/207 - (43%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EAIKLGSTAIGICTPEGVVLAVEKRITSPLMV-PSTVEKIVEVDKHIGCATSGLMADARTLIERA 92
            :|.|.|:|..||...:||:|..::|.|..::| .....||..:..:|.|..:|:.|||..:.:..
 Frog    39 KARKTGTTIAGIIYKDGVILGADRRATDDMVVADKNCAKIHYITDNIYCCGAGVAADAENVTQLL 103

  Fly    93 RVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWH 157
            ......|......:..:.:..:.:.....::            ....|.:|:..|::...|||:.
 Frog   104 SSNLHIHAMTTGRQPRVCTANRILKQFLYRY------------QGHIGASIIVGGVDIKGPQLYS 156

  Fly   158 MDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDISLNTLKQVMEEKL---------N 213
            :.|.|:..|....|:||||..|...|:|.|:|::.|:|.        |:::.|.:         :
 Frog   157 IYPHGSTDRVPFTALGSGSAAAIAVLEDRFKPNMELEEG--------KRLVTEAITAGIMCDLGS 213

  Fly   214 STNVEVMTMTKE 225
            .:.|::..:|||
 Frog   214 GSGVDLCIITKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 48/207 (23%)
proteasome_alpha_type_5 8..222 CDD:239722 45/202 (22%)
psmb7.2XP_002941310.2 proteasome_beta_type_7 45..233 CDD:239732 45/201 (22%)
Pr_beta_C 239..270 CDD:372128
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.