DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha5 and psmb5

DIOPT Version :9

Sequence 1:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:244 Identity:57/244 - (23%)
Similarity:110/244 - (45%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DRGVN-TFSPEGRLFQV---------EYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPS- 62
            ||.|: .....|..|||         |..||.:. |:|.:......||::||:.|.|:...:.| 
 Frog    19 DRAVHCDLDLHGTSFQVLPGAGEGAAEPGIEFLH-GTTTLAFKFRHGVIVAVDSRATAGAYIASQ 82

  Fly    63 TVEKIVEVDKHIGCATSGLMADA----RTLIERARV-ECQNHWFVYNERMSIESCAQAVSTLAIQ 122
            ||:|::|::.::....:|..||.    |.|..:.|: |.:|     .||:|:.:.::.::.:..|
 Frog    83 TVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRN-----KERISVAAASKLLANMVYQ 142

  Fly   123 FGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLF 187
            :...|.|.|.           :..|.:...|.|:::|..|..|.....::||||..|...|...:
 Frog   143 YKGMGLSMGT-----------MICGWDKRGPGLYYVDSEGNRVSGSVFSVGSGSMYAYGVLDRGY 196

  Fly   188 RPDLTLDEAIDISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEV 236
            ..::.::||.:::..::.|.......|..|..:...:|..:...::::|
 Frog   197 NYEMEVEEAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 57/244 (23%)
proteasome_alpha_type_5 8..222 CDD:239722 55/228 (24%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 45/202 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.