DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk4 and CG13138

DIOPT Version :9

Sequence 1:NP_611205.1 Gene:Vajk4 / 36950 FlyBaseID:FBgn0050101 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster


Alignment Length:307 Identity:91/307 - (29%)
Similarity:132/307 - (42%) Gaps:99/307 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DKKAEGDGKTVEKRGLHLGDYHHYQPHHEHIKTVTIEKKIPVPYTVTKHVPYTVEKKIPYEVKVD 88
            :..::.|.|.::.:..|    ||:..||.|||                            |:...
  Fly   155 EHSSKKDAKRMKVKIKH----HHHHHHHNHIK----------------------------ELIKT 187

  Fly    89 VPQPYIVEKKVPVHVKEYVKVPVHVPKPYEV-IKKIPYEVKVPVDKPYEVKVPVPQPYEVIKKIP 152
            |||||.|||.|.|.:::.|:..|||||...| ::||   |.||::|..|..:.:|:|        
  Fly   188 VPQPYPVEKVVHVPIEKIVEKIVHVPKLVNVTVEKI---VHVPIEKIVEKVIHIPKP-------- 241

  Fly   153 YEVKVPVPQPY---EVIKKVPHEVKVEVPVPKPYEVIKKVPYEVKYEVEKPYDVEVPKPYDVEVE 214
                |.||:||   ::|:|:.|       |||||.|::.|||        |.:::||        
  Fly   242 ----VQVPKPYVVEKIIEKIVH-------VPKPYPVLRTVPY--------PVEIKVP-------- 279

  Fly   215 KPYTVVVEKKVPYEVKVPVDKPYKVEVEKPYPVHVKVPVPQPYTVEKKVPYTVEKPVPYEVKVPI 279
                |.:|||||.        |||||||:..||:::  ..:||..|....|. ..|...|.|..:
  Fly   280 ----VHLEKKVPV--------PYKVEVERKVPVYIR--SSEPYKFESSSLYE-SYPRGEEFKFNM 329

  Fly   280 EKPIPVYTEVKVPIHKEIPVPEKYHVEVPIFKHHQEDH----HDYHS 322
            |...|...|     |:...:|...:.. .|:|..:.||    .||.|
  Fly   330 EMDHPPPRE-----HEPSSLPSSNYYN-RIYKSRELDHPPRMEDYQS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk4NP_611205.1 rne <137..313 CDD:236766 51/178 (29%)
CG13138NP_609372.1 IMCp 188..279 CDD:289112 44/120 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.