DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbl and ZC3H10

DIOPT Version :9

Sequence 1:NP_001261046.1 Gene:mbl / 36945 FlyBaseID:FBgn0265487 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001290053.1 Gene:ZC3H10 / 84872 HGNCID:25893 Length:434 Species:Homo sapiens


Alignment Length:428 Identity:86/428 - (20%)
Similarity:141/428 - (32%) Gaps:150/428 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VCREFQRNKCSRQDTECKFAHPP----ANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLK 83
            :||:|.||.|.| ...|::.||.    :|:.|...:...|:|.....|:|  |.|::.|..:..:
Human    41 ICRDFLRNVCKR-GKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSR--PNCRFIHGSKEDE 102

  Fly    84 DQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAVATNPYLTGIPANSYSPYYTTGHLVPALL 148
            |                                                   .|..||.|.|.| 
Human   103 D---------------------------------------------------GYKKTGELPPRL- 115

  Fly   149 GPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEVCREFLRGACKRAESECRFAHPQ---ESVARHDD 210
             ...|.:.|| :.|..:...::::|      :||:||:|.|:|. ::|:|.|.|   |..||...
Human   116 -RQKVAAGLG-LSPADLPNGKEEVP------ICRDFLKGDCQRG-AKCKFRHLQRDFEFDARGGG 171

  Fly   211 GSITVCMDAVKGRCARDPCRYFHPPLHLQAQLKAAQTRATAVAAAAAVW------LYTIYFSILF 269
            |                                      |...:..:|.      ||.||     
Human   172 G--------------------------------------TGGGSTGSVLPGRRHDLYDIY----- 193

  Fly   270 EPSLCMDVKTVGSFYYDNFQFSGMVPFKRPAAEKSG-IPVYQPGATAYQQLMQPYVPVSCEYPQQ 333
                  |:...|        |....|  .|...:.| .|...|...:|:..:.|...|.|...::
Human   194 ------DLPDRG--------FEDHEP--GPKRRRGGCCPPDGPHFESYEYSLAPPRGVECRLLEE 242

  Fly   334 QQQPPPQQQQQQQHQQQN------VLLQQQLQL--SSVITTTSTTATASNNMINNNINNKGIINA 390
            :.....::.::.:.|..|      |||:|..|.  .:.:.|.|:||.|:...:...:......|.
Human   243 ENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVITLSSTAPATEQTLAPTVGTVATFNH 307

  Fly   391 VMASTNITSSATT-----TASSSLLSALGTPPTTTTTA 423
            .:|.|:.|.|:..     .:...|::..|.|....|.|
Human   308 GIAQTHTTLSSQALQPRPVSQQELVAPAGAPAAPPTNA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mblNP_001261046.1 ZnF_C3H1 175..201 CDD:214632 9/25 (36%)
ZC3H10NP_001290053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
ZnF_C3H1 40..62 CDD:214632 9/21 (43%)
ZnF_C3H1 134..158 CDD:214632 10/30 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..217 5/30 (17%)
SPATA1_C 236..>293 CDD:292371 13/56 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..362 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.