DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbl and mbnl2

DIOPT Version :9

Sequence 1:NP_001261046.1 Gene:mbl / 36945 FlyBaseID:FBgn0265487 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_031752014.1 Gene:mbnl2 / 780224 XenbaseID:XB-GENE-961079 Length:390 Species:Xenopus tropicalis


Alignment Length:364 Identity:157/364 - (43%)
Similarity:201/364 - (55%) Gaps:73/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHP 78
            :|::||.|||||:|||..|||.|.||||||||.:.:|:||:|.||:||:||||:|:.  |||.||
 Frog     9 RDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSREN--CKYLHP 71

  Fly    79 PQHLKDQLLINGRNHLALKNA----LMQQMG-IAPG---QPVISGQV-PAVATNPYLTGIPANSY 134
            |.|||.||.|||||:|..:..    |.|||. :.||   ||:.:..| ||:.||      .|.|:
 Frog    72 PTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTQLQPMPTFPVGPALGTN------TAISF 130

  Fly   135 SPYYT-----TGHLVPA-LLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEVCREFLRGACKRAE 193
            :||.|     .| |||. :|...||.....|.|......|.||:.|:|:|||||||.||.|.|.|
 Frog   131 APYLTPVTPGVG-LVPTEILPSTPVIVPGSPPVSVPGSTAAQKLLRTDKLEVCREFQRGNCARGE 194

  Fly   194 SECRFAHPQES-VARHDDGSITVCMDAVKGRCARDPCRYFHPPLHLQAQLKAAQTRA--TAVAAA 255
            ::||||||.:| :...:|.::|||||.:||||.|:.|:|||||.||||::||||.:|  .||||.
 Frog   195 TDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQ 259

  Fly   256 AAVWLYTIY---------------FSILFEPSLCMDVKTVGSFYYDNFQFSGMVPFKRPAAEKS- 304
            ||....|:.               ..:.|.|.:...:.                  ||||.||| 
 Frog   260 AAAAAATVMTQSTAKAMKRPLEATVDLAFPPGVLHPLP------------------KRPALEKSN 306

  Fly   305 -GIPVYQPGATAYQ------QLMQP--YVP---VSCEYP 331
             ...::.|....||      ||.||  :.|   |.|..|
 Frog   307 GASALFNPSVLHYQQALANAQLQQPAAFFPAGSVLCMTP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mblNP_001261046.1 ZnF_C3H1 175..201 CDD:214632 17/25 (68%)
mbnl2XP_031752014.1 ZnF_C3H1 17..40 CDD:214632 17/22 (77%)
ZnF_C3H1 178..202 CDD:214632 16/23 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4389
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4320
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001679
OrthoInspector 1 1.000 - - otm48120
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2627
SonicParanoid 1 1.000 - - X1238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.