DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbl and mbnl1

DIOPT Version :9

Sequence 1:NP_001261046.1 Gene:mbl / 36945 FlyBaseID:FBgn0265487 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001093520.2 Gene:mbnl1 / 767696 ZFINID:ZDB-GENE-060929-704 Length:412 Species:Danio rerio


Alignment Length:426 Identity:159/426 - (37%)
Similarity:211/426 - (49%) Gaps:81/426 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRCN 67
            |:.:|      :|::||.|||||||||..|:|.|.|||||||..:.:|:||:|.||:||:||||:
Zfish     4 NMAHM------RDTKWLTLEVCREFQRGTCARSDAECKFAHPAKSCQVENGRVIACFDSLKGRCS 62

  Fly    68 RDKPPCKYFHPPQHLKDQLLINGRNHL-ALKNALM--QQMGIA----PG---QPV---------- 112
            |:.  |||.|||.|||.||.|||||:| ..||..|  |||.||    ||   ||:          
Zfish    63 REN--CKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQIANAIMPGSQLQPMPMFSVSPSLA 125

  Fly   113 -----ISGQVPAVATNPYLTGIPANSYSPYYTTGHLVPA---LLGPDP----VTSQLGPVVPQTV 165
                 .:....|.|.||||..:     ||...:..::|:   |:...|    |.|..........
Zfish   126 SNASAAAAAAAAAAFNPYLGPV-----SPGLMSAEILPSAPVLMAGSPGVASVPSAANAAAAAAS 185

  Fly   166 QVAQQKIPRSDRLEVCREFLRGACKRAESECRFAHPQES-VARHDDGSITVCMDAVKGRCARDPC 229
            ..|.||:.|:||||||||:.||.|.|.|::||||||.:| :....|.::|||||.:||||:||.|
Zfish   186 AAAAQKLLRTDRLEVCREYQRGNCSRGETDCRFAHPADSPMIDPSDNTVTVCMDYIKGRCSRDKC 250

  Fly   230 RYFHPPLHLQAQLKAAQTRATAVAAAAAVWLYTIYFSILFEPSLCMDVKTVGSFYYD-NFQFSGM 293
            :|||||.||||::||.|.:....:||||:           ..|....:|......:| ....|.|
Zfish   251 KYFHPPAHLQAKIKATQHQVNQASAAAAM-----------TQSAVKSLKRPLEATFDLGIPHSVM 304

  Fly   294 VPF-KRPAAEKS--GIPVYQPGATAYQQLMQ-----------PYVP---------VSCEYPQQQQ 335
            .|. ||||.||:  ...::..|...|||.:.           |.||         ||........
Zfish   305 PPLPKRPALEKANGATSMFSAGMLQYQQALANMQFQQQAAFIPSVPMMHGASPAAVSAATTSATS 369

  Fly   336 QPPPQQQQQQQHQQQNVLLQQQLQLSSVITTTSTTA 371
            .|.......|......:...:.:||..:|:....|:
Zfish   370 VPFASASANQDSSLSKLTTNEYMQLIPIISAEHLTS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mblNP_001261046.1 ZnF_C3H1 175..201 CDD:214632 17/25 (68%)
mbnl1NP_001093520.2 ZnF_C3H1 17..39 CDD:214632 16/21 (76%)
ZnF_C3H1 197..221 CDD:214632 16/23 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581267
Domainoid 1 1.000 130 1.000 Domainoid score I5188
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001679
OrthoInspector 1 1.000 - - otm25318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.