DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbl and mbl-1

DIOPT Version :9

Sequence 1:NP_001261046.1 Gene:mbl / 36945 FlyBaseID:FBgn0265487 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001360647.1 Gene:mbl-1 / 186912 WormBaseID:WBGene00019347 Length:374 Species:Caenorhabditis elegans


Alignment Length:338 Identity:130/338 - (38%)
Similarity:163/338 - (48%) Gaps:81/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANVVNMNSLLNGKDSRWLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIKGRC 66
            ||:|  :.:.|.|||||||:||||||.|.:|:|.|.||||||||.||:||.|:||||||||||||
 Worm    92 ANLV--SQVFNVKDSRWLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIKGRC 154

  Fly    67 NRDKPPCKYFHPPQHLKDQLLINGRNHLALKNAL---MQQMGIAPGQPVISGQVPAVATNPYLTG 128
            .|:.|.|||.|||||:||||||||||||||||.|   :.|.|.....|:::.|..|.|.| .:..
 Worm   155 TRENPKCKYLHPPQHIKDQLLINGRNHLALKNLLSAQLNQTGTPMVNPMMALQQQAAAVN-LIPN 218

  Fly   129 IPANSYSPYYTTGHLVPALLGPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEVCREFLR--GACKR 191
            .|.  |.||| .|.:.|.:| .||.|:   ..|.|.:|.|              ..|.  |....
 Worm   219 TPI--YPPYY-NGMMYPQVL-QDPYTA---AAVNQQLQTA--------------ALLGNVGGLLS 262

  Fly   192 AESECRFAHPQESVARHDDGSITVCMDAVKGRCARDPCRYFHPPLHLQAQ--LKAAQTRATAVAA 254
            |:|...|.....:.|               ....:.|    .|.|.||.:  |:...|....:.:
 Worm   263 AQSAAAFMANSSAAA---------------AAAQQTP----SPLLRLQRKRALEEENTNGNDMTS 308

  Fly   255 AAAVWLYTIYFSILFEPSLCMDVKTVGSFYYDNFQFSGMVPFKRPAAEKSGIPVYQPGATAYQQL 319
            |||.  :|...|:.                      :|.||.|||..:|:|..:|.|.|...||.
 Worm   309 AAAA--HTQLLSLA----------------------AGAVPMKRPTLDKNGAMLYSPVAQQAQQF 349

  Fly   320 -------MQPYVP 325
                   :|.|||
 Worm   350 NPYLLQTLQGYVP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mblNP_001261046.1 ZnF_C3H1 175..201 CDD:214632 5/27 (19%)
mbl-1NP_001360647.1 ZnF_C3H1 108..133 CDD:214632 17/24 (71%)
ZnF_C3H1 142..167 CDD:214632 18/24 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159532
Domainoid 1 1.000 178 1.000 Domainoid score I2118
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I2676
Isobase 1 0.950 - 0 Normalized mean entropy S5175
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001679
OrthoInspector 1 1.000 - - oto20632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12675
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2627
SonicParanoid 1 1.000 - - X1238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.