DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbl and Zc3h10

DIOPT Version :9

Sequence 1:NP_001261046.1 Gene:mbl / 36945 FlyBaseID:FBgn0265487 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_598764.1 Gene:Zc3h10 / 103284 MGIID:2143670 Length:435 Species:Mus musculus


Alignment Length:422 Identity:87/422 - (20%)
Similarity:141/422 - (33%) Gaps:137/422 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VCREFQRNKCSRQDTECKFAHPP----ANVEVQNGKVTACYDSIKGRCNRDKPPCKYFHPPQHLK 83
            :||:|.||.|.| ...|::.||.    :|:.|...:...|:|.....|:|  |.|::.|..:..:
Mouse    41 ICRDFLRNVCKR-GKRCRYRHPDMSEVSNLGVSKNEFIFCHDFQNKECSR--PNCRFIHGSKEDE 102

  Fly    84 DQLLINGRNHLALKNALMQQMGIAPGQPVISGQVPAVATNPYLTGIPANSYSPYYTTGHLVPALL 148
            |                                                   .|..||.|.|.| 
Mouse   103 D---------------------------------------------------GYKKTGELPPRL- 115

  Fly   149 GPDPVTSQLGPVVPQTVQVAQQKIPRSDRLEVCREFLRGACKRAESECRFAHPQ---ESVARHDD 210
             ...|.:.|| :.|..:...::::|      :||:||:|.|:|. ::|:|.|.|   |..||...
Mouse   116 -RQKVAAGLG-LSPADLPNGKEEVP------ICRDFLKGDCQRG-AKCKFRHLQRDFEFDARGGG 171

  Fly   211 GSITVCMDAVKGRCARDPCRYFHPPLHLQAQLKAAQTRATAVAAAAAVWLYTIYFSILFEPSLCM 275
            |:      ...|.....|....|.                         ||.||           
Mouse   172 GT------GGGGSTGSAPPGRRHD-------------------------LYDIY----------- 194

  Fly   276 DVKTVGSFYYDNFQFSGMVPFKRPAAEKSG-IPVYQPGATAYQQLMQPYVPVSCEYPQQQQQPPP 339
            |:...|        |....|  .|...:.| .|...|...:|:..:.|...|.|...:::.....
Mouse   195 DLPERG--------FEDHEP--GPKRRRGGCCPPDGPHFESYECNLAPLRGVECRLLEEENALLR 249

  Fly   340 QQQQQQQHQQQN------VLLQQQLQL--SSVITTTSTTATASNNMINNNINNKGIINAVMASTN 396
            ::.::.:.|..|      |||:|..|.  .:.:.|.|:||.|:...:...:......|..:|.|:
Mouse   250 KRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVMTLSSTAPATEQTLAPTVGTVATFNHGIAQTH 314

  Fly   397 ITSSATT-----TASSSLLSALGTPPTTTTTA 423
            .|.|:..     .:...|::..|.|....|.|
Mouse   315 TTLSSQALQPRPVSQQELVAPTGAPAAPPTNA 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mblNP_001261046.1 ZnF_C3H1 175..201 CDD:214632 9/25 (36%)
Zc3h10NP_598764.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
ZnF_C3H1 40..62 CDD:214632 9/21 (43%)
ZnF_C3H1 134..158 CDD:214632 10/30 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..190 6/54 (11%)
ZapB <243..>279 CDD:368701 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..363 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.