DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30457 and CG17290

DIOPT Version :10

Sequence 1:NP_611198.1 Gene:CG30457 / 36940 FlyBaseID:FBgn0050457 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_611196.2 Gene:CG17290 / 36938 FlyBaseID:FBgn0034201 Length:99 Species:Drosophila melanogaster


Alignment Length:189 Identity:73/189 - (38%)
Similarity:81/189 - (42%) Gaps:92/189 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLVVAVALLAVAHADVSHLSGYNYAPVSIPQPAPLPVAAPAPIKVAPAPVNTYIPPAPAPAPV 65
            ||||::|:|.||.|.||||.||||:|     .||             |||||.|||||||.    
  Fly     1 MKFLIIAIAFLACAFADVSELSGYDY-----QQP-------------APAPVETYIPPAPP---- 43

  Fly    66 QIEVPAPAPAPVAIPAPAPIKVAPAPVNTYIPPAPVQVEIPAPAPAPVAIPAPAPIKVAPAPVNT 130
                                  |||||.|||||||                        |||  .
  Fly    44 ----------------------APAPVETYIPPAP------------------------PAP--E 60

  Fly   131 YIPPAPVSIPAPAPLPVKVAPAPAPVPVLAPQPVLEEIEPVSADGYRYKTVRR-VIRRR 188
            |||||||.                     |.:|::||||..:.|||||||||| |.|.|
  Fly    61 YIPPAPVQ---------------------AEEPIIEEIEQPAQDGYRYKTVRRHVFRHR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30457NP_611198.1 GYR 173..188 CDD:128953 12/15 (80%)
CG17290NP_611196.2 GYR 82..99 CDD:128953 13/17 (76%)

Return to query results.
Submit another query.