DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC16

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_006718084.1 Gene:ZDHHC16 / 84287 HGNCID:20714 Length:384 Species:Homo sapiens


Alignment Length:184 Identity:56/184 - (30%)
Similarity:79/184 - (42%) Gaps:59/184 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VRWLPAL-IILGFLVWSYHVFVYQICIKKVSDYLTIGLLL-----------FFY-HLLLFMFLWT 67
            :||...: ::|..::....|.:..:|:        :.|:|           ||| |..|.:.::.
Human    76 IRWFGVVFVVLVIVLTGSIVAIAYLCV--------LPLILRTYSVPRLCWHFFYSHWNLILIVFH 132

  Fly    68 WFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWI 132
            :::.| ..|...|.|           .|||                 |||.:|      ||.|..
Human   133 YYQAI-TTPPGYPPQ-----------GRND-----------------IATVSI------CKKCIY 162

  Fly   133 IKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAE---VYCFY 183
            .||.|.|||..|:.|||||||||||:.|||..:|.:||..|.|:..   |||.|
Human   163 PKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 33/62 (53%)
ZDHHC16XP_006718084.1 zf-DHHC 155..312 CDD:279823 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.