DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:282 Identity:76/282 - (26%)
Similarity:126/282 - (44%) Gaps:50/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHL--------------LLFM 63
            |...|.||    .|...||        |:..:|.:|...||....:|              |.|.
Human    70 CVGSRALP----WGQRGWS--------CLPTISSWLAGCLLRSCPYLAVKITPAIPAVAGILFFF 122

  Fly    64 FLWTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNY----AARNLPIATCTIDGLV 124
            .:.|..|..|..|..:|   :.:|::...|:|...|...:....|    ..:.:.|...|:.  :
Human   123 VMGTLLRTSFSDPGVLP---RATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVK--L 182

  Fly   125 RYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMV 189
            :||.||.|.:|.||.||..|..||.:.||||||:.|||...|:::|.:|:........::|..::
Human   183 KYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVI 247

  Fly   190 YDLYL---ICGFEVTALKNQHSWNILQYLVCILFNIFTVI----MYTVSLLNVSRNRTTMESAYA 247
            ..:.|   ..|| :.|||:..: ::|:.:|| .|::::::    .:|..   :|.|:||.|....
Human   248 THVILRSQQTGF-LNALKDSPA-SVLEAVVC-FFSVWSIVGLSGFHTYL---ISSNQTTNEDIKG 306

  Fly   248 TYFLLGGKNN-NGFNLG-YFVN 267
            ::....||.| |.::.| .|.|
Human   307 SWSNKRGKENYNPYSYGNIFTN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 41/124 (33%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.