DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:231 Identity:55/231 - (23%)
Similarity:87/231 - (37%) Gaps:59/231 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLF--------YAEV-YCF 182
            |.||.:.||.|:.|||.|..||.:.||||.|:.||:...|.:||:::|.        .|.| ..|
Mouse   151 CPTCDLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTRYFLIYLLTLTASAATIATVTAAF 215

  Fly   183 YLFCVMVYDLYLICGFEVTALKNQHSWNILQ--YLVCILFNIFTVIMYTVSLLNVSRNRTTMESA 245
            .|..|.|.|||     :.|.|.:...:..:.  :|:..||..|..|::.:..:.|..........
Mouse   216 LLRLVTVSDLY-----QETYLDDVGHFQAVDTVFLIQHLFLAFPRIVFLLGFVIVLSMLLAGYLC 275

  Fly   246 YATYFLLGGKNNNGFNLGYFVNFRDLYGDKWY--------LWPFPIFSSRGDGFSFPLAHDRLKE 302
            :|.|.....:..|                :||        .||...:|        |.|..|:  
Mouse   276 FALYLAATNQTTN----------------EWYKGDWAWCQRWPLVAWS--------PSAEPRI-- 314

  Fly   303 VRTGNQKKDNQPTRTQMYKENMNRILGIHQPPFNEE 338
                     :|...:..::.|:..|.....|.:.::
Mouse   315 ---------HQNIHSHGFRSNLREIFLPATPSYKKK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 40/126 (32%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 44/161 (27%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848310
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.