Sequence 1: | NP_611197.1 | Gene: | CG17287 / 36939 | FlyBaseID: | FBgn0034202 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081752.2 | Gene: | Zdhhc24 / 70605 | MGIID: | 1917855 | Length: | 284 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 51/204 - (25%) |
---|---|---|---|
Similarity: | 83/204 - (40%) | Gaps: | 51/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVY 190
Fly 191 DLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMY-TVSLLNVS------------------ 236
Fly 237 ---------RNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKW---YLWPFPIFSSRGD 289
Fly 290 GFSFPLAHD 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17287 | NP_611197.1 | zf-DHHC | 125..243 | CDD:279823 | 35/144 (24%) |
Zdhhc24 | NP_081752.2 | zf-DHHC | 95..232 | CDD:279823 | 37/156 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |