DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_081752.2 Gene:Zdhhc24 / 70605 MGIID:1917855 Length:284 Species:Mus musculus


Alignment Length:204 Identity:51/204 - (25%)
Similarity:83/204 - (40%) Gaps:51/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVY 190
            ||..|....|.|:.||..|.:|:|:.||||..:..||.|||::.|:..|.::        ..::.
Mouse    95 YCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGCCVGFHNYRPFLCLLLHS--------AGVLL 151

  Fly   191 DLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMY-TVSLLNVS------------------ 236
            .:.::.|..::||...||   ..|.|.:|...:.:::. .|||...:                  
Mouse   152 HISVLLGPALSALLQAHS---ALYTVALLLLPWLMLLTGKVSLAQFALAFVVDTCVAGALLCGAG 213

  Fly   237 ---------RNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKW---YLWPFPIFSSRGD 289
                     |.:||.|.|         :.::.::||...|.:...|.:|   :.|||......||
Mouse   214 LLFHGMLLLRGQTTWEWA---------RGHHCYDLGTCHNLQAALGPRWALVWFWPFLASPLPGD 269

  Fly   290 GFSFPLAHD 298
            |.||....|
Mouse   270 GISFQTPGD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 35/144 (24%)
Zdhhc24NP_081752.2 zf-DHHC 95..232 CDD:279823 37/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.