DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:303 Identity:117/303 - (38%)
Similarity:169/303 - (55%) Gaps:19/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCPIGEGHRRVPCCAV-RWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMF 64
            |.|.|.|..|..|..| .|:|.:.|...|.|||:.:..|:||..:.:.....:.|..||||..||
Mouse     1 MAPSGSGGVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHLLFAMF 65

  Fly    65 LWTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKT 129
            :|::::.||..|:....::.:|..:.:.|:|....|....||..||::|||.|.|:.|.:|||..
Mouse    66 VWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDR 130

  Fly   130 CWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYL 194
            |.:|||||.|||..|..|:|||||||||:.|||.|.|:|:|:|||.|:.:||.:   :...||..
Mouse   131 CQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLLYCLF---IAATDLQY 192

  Fly   195 ICGFEVTALKNQHSWNILQYLVCILFNIFTVIMYTVSLLN--------VSRNRTTMESAYATYFL 251
            ...|....|.:      .|....|:|..|...|::|||.:        ||:|::|:| |:.....
Mouse   193 FIRFWTNGLPD------TQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKSTLE-AFRNPVF 250

  Fly   252 LGGKNNNGFNLGYFVNFRDLYGDKWYLWPFPIFSSRGDGFSFP 294
            ..|.:.|||:||:..|.|.::||:...|..|:|||:|||.|||
Mouse   251 RHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 52/125 (42%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 54/130 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848307
Domainoid 1 1.000 52 1.000 Domainoid score I11381
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0000300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100499
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1716
SonicParanoid 1 1.000 - - X260
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.