DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_081582.1 Gene:Zdhhc25 / 70073 MGIID:1917323 Length:279 Species:Mus musculus


Alignment Length:255 Identity:60/255 - (23%)
Similarity:92/255 - (36%) Gaps:66/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PIGEGHRRVPCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWT 67
            |||     :.|....|  ||::.|..|      :::..:...::.|.|......:|||..:.|.:
Mouse    34 PIG-----ILCAMAAW--ALVLSGGWV------LFRDLLIPSNNMLYIVANGVVFHLLASLALAS 85

  Fly    68 WFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWI 132
            ..|.:...|..:|......|:.|.                                  ||..|..
Mouse    86 HLRTMLTDPGSVPLGNPPGPDTVS----------------------------------YCTDCHS 116

  Fly   133 IKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICG 197
            ..|..|.||..|..|:.|.|||||||.||:...|.|||:||..|..:...::.        |:.|
Mouse   117 AIPRTACHCTVCQRCIRKNDHHCPWINNCIGEDNQKYFLLFTMYIGLTSTHVL--------LLLG 173

  Fly   198 FEVTALKNQHSWN-----------ILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMESAY 246
            ..|.....:..|:           :...||.|:..:|.|:|....:..:..::||.|..|
Mouse   174 IPVLCSYMRGEWDSSSTVSLPAPILFLLLVAIMGFLFAVVMLCSQMCVIYSDKTTTELLY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 38/128 (30%)
Zdhhc25NP_081582.1 zf-DHHC 109..230 CDD:279823 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.