DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc21

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_080923.2 Gene:Zdhhc21 / 68268 MGIID:1915518 Length:265 Species:Mus musculus


Alignment Length:301 Identity:77/301 - (25%)
Similarity:118/301 - (39%) Gaps:98/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CCAVRWLPALIILGFLVWSYHVFVYQICIKKV-------SDYLTIGLLLFFYHLLLFMFLWTWFR 70
            ||.     .||:   .||.|::    :.|.|:       ..::...|::.||.:.:|        
Mouse    15 CCM-----GLIV---FVWLYNI----VIIPKIVLFPHYEEGHIPGILIIIFYGISIF-------- 59

  Fly    71 CIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKP 135
            |: ||.||      .|..|..:|..|..|..|.|                 .|...|..|.:::|
Mouse    60 CL-VALVR------ASLTDPGRLPENPKIPHAER-----------------ELWELCNKCNLMRP 100

  Fly   136 DRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVY-CFYL---FCVMVY------ 190
            .|:|||..|..||.:||||||||.|||...|...|:...||.|:. |:.|   ||...|      
Mouse   101 KRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKK 165

  Fly   191 ---DLYLICGFEVTALKNQHSWNILQYL----VCILFNIFTVIMYTVSLLNVSRNRTTMESAYAT 248
               ||:::          :|...|::..    :.:|..| |.:.|| .|:.:..:.|::|     
Mouse   166 RNLDLFVV----------RHELAIMRLAAFMGITMLVGI-TGLFYT-QLIGIITDTTSIE----- 213

  Fly   249 YFLLGGKNNNGF------NLGYFVNFRDLYGDKW-YLWPFP 282
                  |.:|..      ...:...|.:::|.:| .||..|
Mouse   214 ------KMSNCCEEISRPRKPWQQTFSEVFGTRWKILWFIP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 42/134 (31%)
Zdhhc21NP_080923.2 DHHC 92..217 CDD:396215 44/147 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848302
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.