DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC11B

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_016865599.1 Gene:ZDHHC11B / 653082 HGNCID:32962 Length:445 Species:Homo sapiens


Alignment Length:141 Identity:34/141 - (24%)
Similarity:60/141 - (42%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IKPDR---AHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDL-- 192
            |.|.|   ..||.:|:.||...||||.||.|||...|:.:|...:..|......|..:::|.|  
Human   185 IHPSRNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQ 249

  Fly   193 YLI------CGFEVTALKNQHSWNI--------LQYLVCILFNIFTVIMYTVSLLNV-------- 235
            ||:      .......:||.::|.:        :|.|:.::..:..:::..:.|:.:        
Human   250 YLVNPRVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIRMLVLLLDLLGLVQLGQLLIFHI 314

  Fly   236 ---SRNRTTME 243
               ::..||.|
Human   315 YLKAKKMTTFE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 33/139 (24%)
ZDHHC11BXP_016865599.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.