DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and zdhhc14

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:285 Identity:70/285 - (24%)
Similarity:118/285 - (41%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIFVAP 76
            |..|....||:..:|.:::   |||             :|:||               |..|..|
Zfish    83 PFLASNLTPAIPAIGGVLF---VFV-------------MGMLL---------------RASFSDP 116

  Fly    77 VRIPDQWKISPEDVDKLKR----NDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDR 137
            ..:|   :.:||:...::|    |:|..|.........|.:.|...|:.  ::||.||.|.:|.|
Zfish   117 GVLP---RATPEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVK--LKYCFTCKIFRPPR 176

  Fly   138 AHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLIC------ 196
            |.||..|..||.:.||||||:.|||...|:::|.||:........::|..::..:.|..      
Zfish   177 ASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFILSLSFLTIFIFAFVITHVILNALRKALA 241

  Fly   197 ---------------GFEVTALKNQHSWNILQYLVCILFNIFTVI----MYTVSLLNVSRNRTTM 242
                           |.....|......::|:.:|| .|::::::    .:|..   :|.|:||.
Zfish   242 LSTAADFEAVQKDPTGLAFLVLSKTALLDVLEVVVC-FFSVWSIVGLSGFHTYL---ISSNQTTN 302

  Fly   243 ESAYATYFLLGGKNN-NGFNLGYFV 266
            |....::....||.| |.::.|.|:
Zfish   303 EDIKGSWSSKRGKGNYNPYSYGNFI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 39/142 (27%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 40/146 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.