DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and zdhhc4

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_956343.2 Gene:zdhhc4 / 561817 ZFINID:ZDB-GENE-030131-9031 Length:345 Species:Danio rerio


Alignment Length:298 Identity:65/298 - (21%)
Similarity:109/298 - (36%) Gaps:99/298 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GHRRVPC-------------CAVRWLPAL--------------------IILGFLVWSYHVFVYQ 38
            ||::.|.             |..:||.::                    ::|..:|  |..|.|:
Zfish    26 GHQQTPLGQLVGAFTRIVSPCIPQWLQSICYRTMHRLFHQRNNFFLYLHLLLEVVV--YGEFTYE 88

  Fly    39 I---CIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIE 100
            :   |:...|..|:   |...|.||...      .|:|         :.....|...|.::: :.
Zfish    89 VFGFCLDMGSSSLS---LCVPYILLALK------SCLF---------YLCCSRDPGTLTKSN-LS 134

  Fly   101 GASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFH 165
            ...::..|..:...      .|:  .|.||.:|||.|:.|||.|:.||.:.||||.|:.||:...
Zfish   135 AHLKIYQYDEKLFQ------QGM--KCSTCQLIKPARSKHCRVCNRCVQRFDHHCVWVNNCIGAQ 191

  Fly   166 NFKYFILFLFYAEVYCFYLFCVMVYDLYLICGFEV------TALKNQH---SWNILQ-----YLV 216
            |.:||:|:|...        |.|..::.::....:      |.|.:.|   ...|.|     :::
Zfish   192 NTRYFMLYLLSV--------CAMAGNIAVLTTDMLLQTVLRTGLLHAHYIDEQGIQQPAGPLFII 248

  Fly   217 CILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGG 254
            ..||..|..|::.:..|            ...:|||.|
Zfish   249 QHLFLTFPRIVFMLGFL------------VFVFFLLAG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 37/131 (28%)
zdhhc4NP_956343.2 DHHC 152..296 CDD:396215 41/143 (29%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 342..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.