DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC7

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001139020.1 Gene:ZDHHC7 / 55625 HGNCID:18459 Length:345 Species:Homo sapiens


Alignment Length:278 Identity:73/278 - (26%)
Similarity:112/278 - (40%) Gaps:84/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLL----FFY--------HLLLFMFL 65
            |..:.||        || :|..||           :|..:||    |:|        :.|..:.|
Human    50 CAVMTWL--------LV-AYADFV-----------VTFVMLLPSKDFWYSVVNGVIFNCLAVLAL 94

  Fly    66 WTWFRCIFVAPVRIPD--------QWKISPEDVDKLKRNDGI--EGASRVLNYAARNLPIATCTI 120
            .:..|.:...|.:..|        :..:.|..|       ||  ||...|.:.....:|....|.
Human    95 SSHLRTMLTDPEKSSDCRPSACTVKTGLDPTLV-------GICGEGTESVQSLLLGAVPKGNATK 152

  Fly   121 D---------GLVRY-CKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLF 175
            :         |.|.| |..|..|||:|||||..|..|:.||||||||:.|||...|.::|:||..
Human   153 EYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM 217

  Fly   176 YAEVYCFYLFCVMVYDLYLICGFE-VTALKNQHSWN-----------ILQYLVC---ILFNIFTV 225
            |..:...:..        ::|||: ::.::.|  |.           ||...:|   :||..||.
Human   218 YIALSSVHAL--------ILCGFQFISCVRGQ--WTECSDFSPPITVILLIFLCLEGLLFFTFTA 272

  Fly   226 IMYTVSLLNVSRNRTTME 243
            :|:...:.::..:.|.:|
Human   273 VMFGTQIHSICNDETEIE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 43/133 (32%)
ZDHHC7NP_001139020.1 zf-DHHC 168..295 CDD:307600 43/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.