DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC4

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:280 Identity:56/280 - (20%)
Similarity:96/280 - (34%) Gaps:112/280 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIILGFLVWSYHVFVYQICIK-------KVSDYLTIGLLLFFYHL--------------LLFMFL 65
            |::.|.:...|...|:..|.:       .:..||.:|:.|||:.|              |||:.:
Human    73 LVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHV 137

  Fly    66 WTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTC 130
            :.:...:|...||                                                |.||
Human   138 YEFDEVMFPKNVR------------------------------------------------CSTC 154

  Fly   131 WIIKPDRAHHCR---------------TCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVY 180
            .:.||.|:.||.               .|:.||.:.||||.|:.||:...|.:||::::......
Human   155 DLRKPARSKHCSECGSRDSSGTSNSTCVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTAS 219

  Fly   181 C---------FYLFCVMVYDLYLICGFEVTALKNQHSWNILQ--YLVCILFNIFTVIMYTVSLLN 234
            .         |.:..|::.|||     :.|.:.:....:::.  :|:..||..|..|::.:..:.
Human   220 AATVAIVSTTFLVHLVVMSDLY-----QETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVV 279

  Fly   235 VSRNRTTMESAYATYFLLGG 254
            |            ..|||||
Human   280 V------------LSFLLGG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 33/143 (23%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 38/154 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.