DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and dnz1

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001016218.1 Gene:dnz1 / 548972 XenbaseID:XB-GENE-5747351 Length:287 Species:Xenopus tropicalis


Alignment Length:306 Identity:80/306 - (26%)
Similarity:128/306 - (41%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RVPCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIFV 74
            |.||..:..|...:.||:   :.:|.:..:.::..|:.:...|....::|::.|.|....|.:|.
 Frog     6 RDPCGLLCVLLTYLSLGY---ADYVIIRHVLLQHYSEGIWCPLHAVGFNLMVVMLLACHTRAVFS 67

  Fly    75 AP--VRIPDQWKISPEDVDKL-----KRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWI 132
            .|  |.:||    :..|...|     ::||                   |...|..|  |..|..
 Frog    68 DPGTVPLPD----TAIDFSDLRSGTPRKND-------------------TGNEDWTV--CNRCET 107

  Fly   133 IKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMV-------- 189
            .:|.||||||.||.|:.:||||||||.|||...|.||||.||||..:...|...::|        
 Frog   108 YRPPRAHHCRICHRCIRRMDHHCPWINNCVGELNQKYFIQFLFYTGLTSLYAMGLVVATWLWPPK 172

  Fly   190 --YDLYLICGFEVTALKN-QHSWNILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFL 251
              |......|  |.|..| |.:..||..:..:||.:|..:::...::::..:.|.:|........
 Frog   173 RGYVEEPDTG--VPAHSNVQIAHYILLLVESVLFGLFVTVIFYDQIVSIMNDETPIEQLRKRLLK 235

  Fly   252 LGGKNNNGFNLGYFVNFRDLYGDKWYL-WPFPIF---SSRGDGFSF 293
            ...:.............|:::|..:.: |.||..   :|.|..:|:
 Frog   236 EARREVAHTRKPKMALLREVFGRGYMMCWIFPCNCAPASGGPAYSY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 46/128 (36%)
dnz1NP_001016218.1 DHHC 10..>162 CDD:418707 55/179 (31%)
DHHC 96..231 CDD:396215 49/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.