DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:264 Identity:71/264 - (26%)
Similarity:129/264 - (48%) Gaps:37/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIILGFLVWS--YHVFVYQICIKKVSDYL-TIGLLLFFYHLLLFMFLWTWFRCIFVAPVRIPDQW 83
            |.::..||.|  :..|..:...:|::..: .:|.:|||:      .:.|..|..|..|..:|   
  Rat    66 LTLILILVTSGLFFAFDCRYLAEKITPAIPVVGGILFFF------VMGTLLRTSFSDPGVLP--- 121

  Fly    84 KISPEDVDKLKRNDGIEGASRVLNY----AARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTC 144
            :.:|::...|:|...|...:....|    ..:.:.|...|:.  ::||.||.|.:|.||.||..|
  Rat   122 RATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVK--LKYCFTCKIFRPPRASHCSLC 184

  Fly   145 HMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLI-----CGFEVTALK 204
            ..||.:.||||||:.|||...|:::|.:|:........::|..::  .::|     .|| :.|||
  Rat   185 DNCVEQFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVI--THVIHRSQQKGF-LDALK 246

  Fly   205 NQHSWNILQYLVCILFNIFTVI----MYTVSLLNVSRNRTTMESAYATYFLLGGKNN-NGFNLG- 263
            :..: ::|:.::| .|:::::|    .:|..   :|.|:||.|....::....||.| |.::.| 
  Rat   247 DSPA-SVLEAVIC-FFSVWSIIGLSGFHTYL---ISSNQTTNEDIKGSWSNKRGKENYNPYSYGN 306

  Fly   264 YFVN 267
            .|.|
  Rat   307 IFTN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 41/126 (33%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 42/130 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.