DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and zdhhc23b

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001003757.1 Gene:zdhhc23b / 445301 ZFINID:ZDB-GENE-040808-13 Length:425 Species:Danio rerio


Alignment Length:302 Identity:79/302 - (26%)
Similarity:122/302 - (40%) Gaps:93/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVRWLPALIILGFL----VWSYHVFVYQICIKKVSDYLTIGLLLF--FYHLLLFM---------- 63
            |:.:|..:|:|..:    :| |:.|.::   ||......:||.||  ||...||:          
Zfish    99 ALHYLLGIIMLTAMPITVLW-YYFFTHR---KKGRTLFFLGLALFSLFYMFYLFLTQVVPRGEVT 159

  Fly    64 ----------------FLWTWFRCIFVAPVRIPDQ------WKISPEDVDKLKRNDGIEGA---- 102
                            ||....|...:...| |.:      :..:|.|||.:..|    ||    
Zfish   160 ELQLAVVTAGVALTVIFLMLTKRGPGLVRPR-PSETHSTVTYHSTPPDVDGVYLN----GARHQV 219

  Fly   103 ---SRVLNYAARNLPIATCTIDGLVR--YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCV 162
               |||.:......|......:|:.:  :|..|.:::|.||.|||.|.:|||::||||.||.:||
Zfish   220 VIGSRVASSEHTGEPGTEEEEEGVQKRNWCAVCKVVRPRRAGHCRICGVCVLRLDHHCVWINSCV 284

  Fly   163 HFHNFKYFILFLFYAEVYCFYLFCVMVYDLYL--ICGFE--VTAL------KNQHSWNILQYLVC 217
            ...|.:.|:|.|.:     |.|..:....|.|  :|..:  :|||      .:|:|     ..:|
Zfish   285 GLANHRTFLLTLLF-----FLLTSIFGISLVLASVCPDQRVLTALFYCPDVYSQYS-----SALC 339

  Fly   218 ILFNIFTVIMYT------------VSLLNVSRNRTTMESAYA 247
                 ||...|:            :.:||:|.|.|..|:..|
Zfish   340 -----FTCAWYSSIVTGGLLHLLLLQILNISLNVTEREARLA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 43/141 (30%)
zdhhc23bNP_001003757.1 7TMR-DISM_7TM <62..179 CDD:284997 19/83 (23%)
zf-DHHC <244..>350 CDD:303066 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.