DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and CG4956

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:311 Identity:86/311 - (27%)
Similarity:130/311 - (41%) Gaps:85/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCCAVRWLPALIILGFLVWSYHVFVYQIC--IKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIFV 74
            |.||:.   .|.::|.|      |||::|  :.:::|...|      :|.|      .||..|:.
  Fly    43 PFCAIF---LLCLIGLL------FVYELCYVLPQITDPHGI------WHKL------CWFMGIYT 86

  Fly    75 APVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDG---LVRYCKTCWIIKPD 136
            . :.|...|.:.      ...|..::  |.||.   |..|:|     |   |..||.||..:.|.
  Fly    87 V-INILGNWWLG------CMTNTSVD--SLVLE---RQYPVA-----GEAHLWHYCSTCQKLVPP 134

  Fly   137 RAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFY-------AEVYCFYL----FCVMVY 190
            |:.||..|::|:||.||||.:..:|:...|.:||:.|||:       |.||...|    ...:|.
  Fly   135 RSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQALVYNGILNWTNKAFLVV 199

  Fly   191 DLYLICGFEVTALKNQHSWNILQYLVCILF--NIF----TVIMYTVSLLNVSRNRTTMESAYATY 249
            |..|:. |:.|.......|   :|.:..||  |:|    .:.|:...::.|.||.|       .|
  Fly   200 DPLLLM-FQDTTQDADFKW---KYTIANLFKLNLFLFGVPLFMFVFQMIMVYRNST-------CY 253

  Fly   250 FLLGGKNNNGFNLGYFVNFRDLYGDKWYLWPF--PIFSSRGDGFSFPLAHD 298
            .:|    :..:::|:..|| |:...|...|.|  |..||       ||..|
  Fly   254 KML----DRSYDVGWRRNF-DMVLGKRRFWIFFSPTISS-------PLPTD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 43/134 (32%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 42/131 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467488
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.