DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and CG17195

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:204 Identity:53/204 - (25%)
Similarity:88/204 - (43%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAE---VYCFYL 184
            |..||::|..::..|:.||..|:.|:|:.||||.:...|:..:|.::|..|.||..   |..|..
  Fly   101 LWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFAT 165

  Fly   185 FCVMVYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMY---------TVS-LLNVSRNR 239
            ||:.:.               |:..|.:. |..::||:.|...:         |:: |||:|   
  Fly   166 FCMFIL---------------QNGGNFMS-LSSVIFNLITRTFFQNYTGNTFETIAFLLNIS--- 211

  Fly   240 TTMESAYATYFLLG------GKNNNGFN-------LGYFVNFRDLYGDKWYLWPF--PIFSSRGD 289
                ::|...|:|.      .:|:..:|       ||:..|.:.:.|.:. ||.|  |:..|   
  Fly   212 ----ASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFRKNCQTIMGQRG-LWTFISPLLKS--- 268

  Fly   290 GFSFPLAHD 298
                ||.||
  Fly   269 ----PLPHD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 34/130 (26%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 38/153 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467491
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.