DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and CG17197

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:206 Identity:50/206 - (24%)
Similarity:85/206 - (41%) Gaps:51/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVY 190
            ||..|..:.|.|:.||..|..|:||.|.||.:..:||..:|.:||..|..:           |..
  Fly   106 YCDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLF-----------MAL 159

  Fly   191 DLYLICGFEVTALKNQHSWNILQYL-------------VCILFN--IFTVIMYTVSL-LNVSRNR 239
            ...:.....:.|.....|::.|.:|             :.::.|  :|...:.:|.: |:|.:|.
  Fly   160 GTGVALATHIIATLKYFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNN 224

  Fly   240 TTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKWYLWPF--PIFSSRGDGFSFPLAHD---- 298
            .|:...|          ::.::||.:.||:.:.|.|.: |.|  |...|       ||.||    
  Fly   225 GTLHKFY----------SDTYDLGLWENFKLILGGKGF-WTFLSPTVKS-------PLPHDGAQW 271

  Fly   299 RLKEVRTGNQK 309
            ::|.|:..:.|
  Fly   272 KIKRVQHHSPK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 32/132 (24%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919
zf-DHHC 100..>198 CDD:279823 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.