DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and CG5196

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:311 Identity:79/311 - (25%)
Similarity:116/311 - (37%) Gaps:101/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FYHLLLFMFLWT-----WFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPI 115
            |.|..||:.|.|     :.......|..:|.||  .|:|....:                     
  Fly    47 FAHQALFLLLSTLATFNYVMATLTGPGLMPKQW--HPKDPKDAQ--------------------- 88

  Fly   116 ATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFL------ 174
                   .::|||.|...|..|:||||.|..||.|||||||||.:||.:.|..||..||      
  Fly    89 -------FLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILG 146

  Fly   175 -----------FYAEVYCFYLFCVMVYDLYLICGFEVTALKNQHSWNILQYLVCIL---FNIFTV 225
                       |:..:|.:|         ||..|....|   ...:.:|..::|||   ..|..|
  Fly   147 SLQGTVVLCCSFWRGIYRYY---------YLTHGLAHLA---SVQFTLLSIIMCILGMGLAIGVV 199

  Fly   226 I----MYTVSLLNVSRNRTTME------SAYATY--------FLLGGKNNNGFNLGYFVNFRDLY 272
            |    :..:.|..:..|:|.:|      :.|..|        ||.      .::||:..|.|.::
  Fly   200 IGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLY------PYDLGWRANLRLVF 258

  Fly   273 GDKWYLWPFPIFSSRGDGFSFPLAH--DRLKEVRTGNQKKDNQPTRTQMYK 321
            .|:        ...||||..:|:..  |:....|....:|:.:..||:.:|
  Fly   259 NDE--------CQKRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRTFK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 46/141 (33%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 47/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467472
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.