DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_038966311.1 Gene:Zdhhc18 / 362613 RGDID:1309334 Length:482 Species:Rattus norvegicus


Alignment Length:238 Identity:65/238 - (27%)
Similarity:109/238 - (45%) Gaps:36/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALIILGFLVWSYHVFVYQICIKKVSDYL--TIGLLLFFYHLLLFMFLWTWFRCI----FVAPVRI 79
            ||.:|..|..:...|::. |     .||  |:.|.:.....:||.|:.:   |:    |..|..:
  Rat    93 ALTLLLILSTTILFFIFD-C-----PYLARTLTLAIPIIAAILFFFVMS---CLLQTSFTDPGIL 148

  Fly    80 PDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDG---LVRYCKTCWIIKPDRAHHC 141
            |.........::|...|.|    |.......|...:   .|:|   .::||.||.:.:|.|..||
  Rat   149 PRATICEAAALEKQIDNTG----SSTYRPPPRTREV---MINGQMVKLKYCFTCKMFRPPRTSHC 206

  Fly   142 RTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLF-CVMVYDLYLICGFE-VTALK 204
            ..|..||.:.||||||:.|||...|:::|..|:........::| ||:.:...|..|.. ::|||
  Rat   207 SVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLLSQGSNFLSALK 271

  Fly   205 NQHSWNILQYLVCILFNIFTVI----MYTVSLLNVSRNRTTME 243
            ...: ::|:.::| .|:|::::    .:|..   |:.|.||.|
  Rat   272 KTPA-SVLELVIC-FFSIWSILGLSGFHTYL---VASNLTTNE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 40/123 (33%)
Zdhhc18XP_038966311.1 DHHC 189..312 CDD:396215 41/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.