DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:371 Identity:93/371 - (25%)
Similarity:137/371 - (36%) Gaps:130/371 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHL----------LLF----MFLWTW 68
            |.| :|.||         |..||    |....|..:|:::.|          :|.    |.|:.:
  Rat    22 WGP-IIALG---------VIAIC----STMAMIDSVLWYWPLHTTGGSVNFIMLINWTVMILYNY 72

  Fly    69 FRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGL-VRYCKTCWI 132
            |..:|..|..:|..||  ||:..                             |.: ::|||.|..
  Rat    73 FNAMFAGPGFVPRGWK--PENPQ-----------------------------DSMYLQYCKVCQA 106

  Fly   133 IKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICG 197
            .|..|:||||.|:.||:|||||||||.||....|...|.|||..|.:.|.:...:.|..:|    
  Rat   107 YKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNHASFTLFLLLAPLGCTHAAFIFVMTMY---- 167

  Fly   198 FEVTALKNQHS--WNILQY----------------LVCILFNIFTV-----------IMYTVSLL 233
               |.|.|:.|  ||.::.                |......:|.:           :::.:.:.
  Rat   168 ---TQLYNRLSFGWNTVKIDMSAARRDPPPIVPFGLAAFAATLFALGLALGTTIAVGMLFFIQIK 229

  Fly   234 NVSRNRTTMES-------AYATYFLLGGKNNNGFNLGYFVNFRDLYGDKW------YLWP-FPIF 284
            .:.||:|::||       ....|:.|.         ..||...|: |.||      :.|. .|  
  Rat   230 IILRNKTSIESWIEEKAKDRIQYYQLD---------EVFVFPYDM-GSKWKNLKQVFTWSGVP-- 282

  Fly   285 SSRGDGFSFPL---AHDRLKEVRTGNQKKDNQPTRTQMYK--ENMN 325
              .|||..:|:   .|.....:....||.|.: .|:..||  |:.|
  Rat   283 --EGDGLEWPIREGCHQYSLTIEQLKQKADKR-VRSVRYKVVEDYN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 44/146 (30%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 45/152 (30%)
SH3_2 317..394 CDD:400139 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.