DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and GABPI

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:237 Identity:45/237 - (18%)
Similarity:89/237 - (37%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMF---------------------- 64
            |.::||.:|...  :.:....:.:.:|:..:...||.:::|.|                      
  Fly   127 LTLVGFTIWGME--LAKRTATRTNFFLSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAA 189

  Fly    65 LWTWFRCIFVAPVR-IPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPI---ATCTID---- 121
            |:..:....::|:. :..|:..:|:|     ...||..||.....|.....:   :..::|    
  Fly   190 LYCLYSAKALSPLNLVSAQYGTTPKD-----ELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEV 249

  Fly   122 -------------GLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILF 173
                         |....|:.|..:.|.||:||..|..||.:.|||..|:..|:...|:.::|:.
  Fly   250 GDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVG 314

  Fly   174 LFYAEVYCFYLFCVMVYDLYLICGFEVTALKNQHSWNILQYL 215
            |..:|:             .|:.|..:|.....|.:.:::.|
  Fly   315 LALSEI-------------ALLLGANLTLTSICHPFMVVRPL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 24/91 (26%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.