DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and CG17075

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:228 Identity:54/228 - (23%)
Similarity:83/228 - (36%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIILGFLVWSYHVFV--YQICIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIFVAPV-----RI 79
            |::|.|.|.||.|.:  :...|:.....|..||.|        :.:.:....:...|.     |:
  Fly   119 LVLLLFGVASYWVLIPAFHARIQGPLYGLITGLYL--------VHIASHLTALLTDPADKELRRV 175

  Fly    80 PDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWI-IKPDRAHHCRT 143
            ....:|.|| .|:.|.:..||...                       |..|.| ...:|..||..
  Fly   176 HRNDRIVPE-FDRSKHSHVIENGR-----------------------CHLCNIRTSSNRTKHCSV 216

  Fly   144 CHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDL--YLICGFEVTALKNQ 206
            |:.||.|.||||.|:.:|:...|:..|::.:..|.|....:...:|..:  |.|          |
  Fly   217 CNKCVGKFDHHCKWLNHCIGSRNYVAFLMCVVSAVVATLVIVAAVVAQIVFYYI----------Q 271

  Fly   207 HSWNILQYLVCILFNIFTV-----IMYTVSLLN 234
            ..|  |.:..|...:..|:     |..|:||.|
  Fly   272 PDW--LSFYWCPTESSHTIESGDFINITLSLSN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 33/118 (28%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.