DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and zdhhc6

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001191086.1 Gene:zdhhc6 / 324468 ZFINID:ZDB-GENE-030131-3189 Length:412 Species:Danio rerio


Alignment Length:330 Identity:82/330 - (24%)
Similarity:140/330 - (42%) Gaps:90/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLL--LFMFLWTWFRCIFVAPVRIPDQW 83
            ::.||..::|.:.:.             |.|..:.|..|:  ..:.|:.:|..:||.|..||.:|
Zfish    36 SMAILDSIIWYWPLD-------------TTGGSINFIMLINWTVLILYNYFNAMFVGPGYIPLEW 87

  Fly    84 KISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCV 148
            |  ||     |:.|        :.|               :::|:.|...|..|:||||.|:.||
Zfish    88 K--PE-----KQQD--------IMY---------------LQFCRLCQGYKAPRSHHCRKCNRCV 122

  Fly   149 LKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFY---LFCVMVY-DLYLICGF-------EVTA 202
            :|||||||||.||....|..||..||..|.:.|.:   :|.:.:| .||....|       :::|
Zfish   123 MKMDHHCPWINNCCGHLNHAYFTSFLLLAPLGCIHAALIFIMTMYTQLYDRISFGWSSVKIDMSA 187

  Fly   203 LKNQH----SWNILQYLVCILF--------NIFTVIMYTVSLLNVSRNRTTMES-------AYAT 248
            .::.|    .::|..: ...||        .|...:::.:.:..:.||||::|:       ....
Zfish   188 ARHIHHPIMPFSIAAF-AATLFALGLALGTTIAVGMLFFIQMKVILRNRTSIEAWIEEKAKDRIQ 251

  Fly   249 YFLLGGKNNNGFNLG-YFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLAHDRLKE----VRTGNQ 308
            |:..|......::|| .:.||:.::  .|...|.      |||..:|: |::..:    :....|
Zfish   252 YYQTGEDFIFPYDLGSRWENFKQVF--TWSGAPM------GDGIEWPV-HEKCDQYTLTIEQLKQ 307

  Fly   309 KKDNQ 313
            |.|.:
Zfish   308 KHDKR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 44/140 (31%)
zdhhc6NP_001191086.1 DHHC 95..241 CDD:396215 46/161 (29%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9H6R6 409..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.