DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:255 Identity:74/255 - (29%)
Similarity:113/255 - (44%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YLTIGLL-----LFF-----------------YHLLLFMF-LWTWFRCIF----VAPVRIPDQWK 84
            |||:.|:     |||                 :..:||:| :.|..|..|    |.|..:||:..
  Rat    39 YLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAA 103

  Fly    85 ISPEDVDKLKR--NDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMC 147
            ....:::....  ..|.....|:.|:...|..:.       ::||.||.|.:|.||.||..|..|
  Rat   104 FIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVK-------LKYCYTCKIFRPPRASHCSICDNC 161

  Fly   148 VLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFC---VMVYDLYLICGFEVTALKNQHSW 209
            |.:.||||||:.|||...|::||.||:....:...|:|.   |.|....|..|| :..|| :...
  Rat   162 VERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGF-LETLK-ETPG 224

  Fly   210 NILQYLVCILFNIFTVIMYT-VSLLNVSRNRTTMESAYATYFLLGGKN--NNGFNLGYFV 266
            .:|:.|:| .|.:::|:..| .....|:.|:||.|....::   .|||  .|.::.|..|
  Rat   225 TVLEVLIC-FFTLWSVVGLTGFHTFLVALNQTTNEDIKGSW---TGKNRVQNPYSHGNIV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 46/121 (38%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 47/125 (38%)
ANXA2R <284..>343 CDD:292349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.