DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:255 Identity:61/255 - (23%)
Similarity:94/255 - (36%) Gaps:66/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PIGEGHRRVPCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWT 67
            |||     :.|....|  ||::.|  .|   |.|..:.|.. ::.|.|......:|||..:.|.:
  Rat    34 PIG-----ILCAMATW--ALVLSG--GW---VLVRDLLIPS-NNMLYIVANGMIFHLLASLALVS 85

  Fly    68 WFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWI 132
            ..|.:...|..:|...:..|:.|.                                  ||..|..
  Rat    86 HLRTMLTDPGSVPLGNRPGPDTVS----------------------------------YCPDCRS 116

  Fly   133 IKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICG 197
            ..|.||.||..|..|:.|.||||||:.|||...|.|||:||:.|..:...::.        |:.|
  Rat   117 AIPKRAAHCAVCKRCIRKNDHHCPWVNNCVGEDNQKYFLLFIMYIGLSGTHVL--------LLLG 173

  Fly   198 FEVTALKNQHSWN-----------ILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMESAY 246
            ..|.....:..|:           :...||.::..:.:.:|....:..:..::||.|..|
  Rat   174 IPVLCSYARGEWDSSSSVSPPAPILFLLLVALMGFVLSSVMLCTQMCTIYTDKTTTELLY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 36/128 (28%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 36/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.