DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:218 Identity:49/218 - (22%)
Similarity:78/218 - (35%) Gaps:72/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICGFE 199
            |...|.||.|....|:.||||.:..||:...|.:.||||..|..:.|.|         .::.|  
  Rat    91 PPSTHFCRVCARVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLY---------SMVAG-- 144

  Fly   200 VTALKNQHSWNILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLG- 263
                        :.|:..:|         ::|..:.....|.:.::.:.:|       :|..|| 
  Rat   145 ------------VAYISAVL---------SISFAHPLAFLTLLPTSISQFF-------SGAVLGS 181

  Fly   264 -YFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLA------HDRLKEVR--TGNQKKDNQPTRTQM 319
             .||..      ..|||           |:..||      |..|..:|  |..|.:.....|.:.
  Rat   182 DMFVIL------MLYLW-----------FAVGLACAGFCCHQLLLILRGQTRYQVRKGVAVRARP 229

  Fly   320 YKENMNRI------LGIHQPPFN 336
            :::|:..:      ||:..|.||
  Rat   230 WRKNLQEVFGKRWLLGLLVPMFN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 25/107 (23%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 41/182 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.