Sequence 1: | NP_611197.1 | Gene: | CG17287 / 36939 | FlyBaseID: | FBgn0034202 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037436.1 | Gene: | ZDHHC1 / 29800 | HGNCID: | 17916 | Length: | 485 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 52/205 - (25%) |
---|---|---|---|
Similarity: | 76/205 - (37%) | Gaps: | 43/205 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 PCCAVRWLPALIILGFLVWSYHVFVYQICIKKV-SDYLTIGLLLFFYHLLLFMFLWTWFRCIFVA 75
Fly 76 PVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHH 140
Fly 141 CRTCHMCVLKMDHHCPWIVNCVHFHNFKYF----------ILFLFYAEVYCFYLFCVMVYDLYLI 195
Fly 196 CGFEVTALKN 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17287 | NP_611197.1 | zf-DHHC | 125..243 | CDD:279823 | 31/91 (34%) |
ZDHHC1 | NP_037436.1 | Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 | 1..271 | 52/205 (25%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..41 | ||||
zf-DHHC | 129..284 | CDD:307600 | 33/98 (34%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..358 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 462..485 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165157916 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |