DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC1

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens


Alignment Length:205 Identity:52/205 - (25%)
Similarity:76/205 - (37%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCCAVRWLPALIILGFLVWSYHVFVYQICIKKV-SDYLTIGLLLFFYHLLLFMFLWTWFRCIFVA 75
            |...|.|   |:.|.|.|..:.:.|..:....| :.|..:| .:|..||::.:            
Human    50 PLQIVAW---LLYLFFAVIGFGILVPLLPHHWVPAGYACMG-AIFAGHLVVHL------------ 98

  Fly    76 PVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHH 140
                   ..:|.:..|...|:....|...:.|.:..     ...|:.|  :|..|.:....|:.|
Human    99 -------TAVSIDPADANVRDKSYAGPLPIFNRSQH-----AHVIEDL--HCNLCNVDVSARSKH 149

  Fly   141 CRTCHMCVLKMDHHCPWIVNCVHFHNFKYF----------ILFLFYAEVYCFYLFCVMVYDLYLI 195
            |..|:.||...||||.|:.|||...|::.|          :|.|.....|.|..|.|....|...
Human   150 CSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTN 214

  Fly   196 CGFEVTALKN 205
            ..|||  |||
Human   215 RHFEV--LKN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 31/91 (34%)
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 52/205 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
zf-DHHC 129..284 CDD:307600 33/98 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.