DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:205 Identity:53/205 - (25%)
Similarity:76/205 - (37%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PCCAVRWLPALIILGFLVWSYHVFVYQICIKKV-SDYLTIGLLLFFYHLLLFMFLWTWFRCIFVA 75
            |...|.|   |:.|.|.|..:.|.|..:....| :.|..:| .:|..||::.:            
  Rat    47 PLQIVAW---LLYLFFAVIGFGVLVPLLPHHWVPAGYACMG-AIFAGHLVVHL------------ 95

  Fly    76 PVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHH 140
                   ..:|.:..|...|:....|...:.|.:..     ...|:.|  :|..|.:....|:.|
  Rat    96 -------TAVSIDPADANVRDKSYSGPLPIFNRSQH-----AHVIEDL--HCNLCDVDVSARSKH 146

  Fly   141 CRTCHMCVLKMDHHCPWIVNCVHFHNFKYF----------ILFLFYAEVYCFYLFCVMVYDLYLI 195
            |..|:.||...||||.|:.|||...|::.|          :|.|.....|.|..|.|....|...
  Rat   147 CSACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTN 211

  Fly   196 CGFEVTALKN 205
            ..|||  |||
  Rat   212 QHFEV--LKN 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 31/91 (34%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 33/98 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.